Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (6 families) has extra strand located between strands 2 and 3 |
Family c.72.1.0: automated matches [191321] (1 protein) not a true family |
Protein automated matches [190117] (34 species) not a true protein |
Species African malaria mosquito (Anopheles gambiae) [TaxId:7165] [196378] (1 PDB entry) |
Domain d3looc_: 3loo C: [196379] automated match to d2i6aa_ complexed with b4p, cl, mg |
PDB Entry: 3loo (more details), 2 Å
SCOPe Domain Sequences for d3looc_:
Sequence, based on SEQRES records: (download)
>d3looc_ c.72.1.0 (C:) automated matches {African malaria mosquito (Anopheles gambiae) [TaxId: 7165]} lrdgmlvglgnplldisavvekdllnkydmqpnnailaeekhmpmyqeliekyqaeyiag gsvqnslrvaqwilqrprtaiffgcvgqdeyarileeratsngvnvqyqrsatsptgtca vlvtgtqrslcanlaaandftpehlrsdgnraylqgaqffyvsgffftvsfesalsvake aaatgrmfmmnlsapfvpqfyknnleeifpyvdvlfgneteaialakefnygtedlreig kriaalpkengkrkriviitqgsdpvllieagtdnvrefpvqklapeqmvdtngagdafv ggflaqllqsrtvdvcikcgiwaareiiq
>d3looc_ c.72.1.0 (C:) automated matches {African malaria mosquito (Anopheles gambiae) [TaxId: 7165]} lrdgmlvglgnplldisavvekdllnkydmqpnnailaeekhmpmyqeliekyqaeyiag gsvqnslrvaqwilqrprtaiffgcvgqdeyarileeratsngvnvqyqrsatsptgtca vlvtgtqrslcanlaaandftpehlrsdgnraylqgaqffyvsgffftvsfesalsvake aaatgrmfmmnlsapfvpqfyknnleeifpyvdvlfgneteaialakefnygtedlreig kriaalpkengkrkriviitqgsdpvllieagtdnvrefpvqklngagdafvggflaqll qsrtvdvcikcgiwaareiiq
Timeline for d3looc_: