Lineage for d3logb_ (3log B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938664Fold d.161: ADC synthase [56321] (1 superfamily)
    duplication: contains four repeats of alpha-beta(2)-beta motif arranged in a 4 layer core structure: alpha/beta/beta/alpha; orthogonally packed beta-sheets
  4. 1938665Superfamily d.161.1: ADC synthase [56322] (2 families) (S)
    the active site is formed by additional structures inserted into the core structure
  5. 1938666Family d.161.1.1: ADC synthase [56323] (6 proteins)
  6. 1938687Protein Salicylate synthase MbtI [143945] (1 species)
    Mycobactin synthetase protein I
  7. 1938688Species Mycobacterium tuberculosis [TaxId:1773] [143946] (9 PDB entries)
    Uniprot Q7D785 15-449
  8. 1938690Domain d3logb_: 3log B: [180474]
    automated match to d2g5fa1
    complexed with co3, gol, na, sin

Details for d3logb_

PDB Entry: 3log (more details), 1.73 Å

PDB Description: crystal structure of mbti from mycobacterium tuberculosis
PDB Compounds: (B:) Isochorismate synthase/isochorismate-pyruvate lyase mbtI

SCOPe Domain Sequences for d3logb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3logb_ d.161.1.1 (B:) Salicylate synthase MbtI {Mycobacterium tuberculosis [TaxId: 1773]}
smselsvatgavstasssipmpagvnpadlaaelaavvtesvdedyllyecdgqwvlaag
vqamveldsdelrvirdgvtrrqqwsgrpgaalgeavdrllletdqafgwvafefgvhry
glqqrlaphtplarvfsprtrimvsekeirlfdagirhreaidrllatgvrevpqsrsvd
vsddpsgfrrrvavavdeiaagryhkvilsrcvevpfaidfpltyrlgrrhntpvrsfll
qlggiralgyspelvtavradgvviteplagtralgrgpaidrlarddlesnskeiveha
isvrssleeitdiaepgsaavidfmtvrergsvqhlgstirarldpssdrmaalealfpa
vtasgipkaagveaifrldecprglysgavvmlsadggldaaltlraayqvggrtwlrag
agiieeseperefeetceklstltpylvar

SCOPe Domain Coordinates for d3logb_:

Click to download the PDB-style file with coordinates for d3logb_.
(The format of our PDB-style files is described here.)

Timeline for d3logb_: