Class a: All alpha proteins [46456] (286 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
Protein automated matches [190360] (3 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [187191] (5 PDB entries) |
Domain d3lnqa_: 3lnq A: [180423] automated match to d1fjla_ protein/DNA complex; complexed with act |
PDB Entry: 3lnq (more details), 2.25 Å
SCOPe Domain Sequences for d3lnqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lnqa_ a.4.1.1 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} ryrttftsfqleelekafsrthypdvftreelamkiglteariqvwfqnrrakwrkqe
Timeline for d3lnqa_: