Lineage for d3lnqa_ (3lnq A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1720411Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1720412Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 1720602Protein automated matches [190360] (3 species)
    not a true protein
  7. 1720603Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [187191] (5 PDB entries)
  8. 1720605Domain d3lnqa_: 3lnq A: [180423]
    automated match to d1fjla_
    protein/DNA complex; complexed with act

Details for d3lnqa_

PDB Entry: 3lnq (more details), 2.25 Å

PDB Description: Structure of Aristaless homeodomain in complex with DNA
PDB Compounds: (A:) Homeobox protein aristaless

SCOPe Domain Sequences for d3lnqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lnqa_ a.4.1.1 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ryrttftsfqleelekafsrthypdvftreelamkiglteariqvwfqnrrakwrkqe

SCOPe Domain Coordinates for d3lnqa_:

Click to download the PDB-style file with coordinates for d3lnqa_.
(The format of our PDB-style files is described here.)

Timeline for d3lnqa_: