Lineage for d3li2a_ (3li2 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1878032Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 1878139Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 1878387Family c.92.2.0: automated matches [191548] (1 protein)
    not a true family
  6. 1878388Protein automated matches [190944] (28 species)
    not a true protein
  7. 1878461Species Staphylococcus aureus [TaxId:426430] [225834] (2 PDB entries)
  8. 1878463Domain d3li2a_: 3li2 A: [212895]
    automated match to d3tefa_
    complexed with act, fe, sf8, zn

Details for d3li2a_

PDB Entry: 3li2 (more details), 2.2 Å

PDB Description: Closed Conformation of HtsA Complexed with Staphyloferrin A
PDB Compounds: (A:) Ferrichrome ABC transporter lipoprotein

SCOPe Domain Sequences for d3li2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3li2a_ c.92.2.0 (A:) automated matches {Staphylococcus aureus [TaxId: 426430]}
astisvkdengtvkvpkdakrivvleysfadalaaldvkpvgiaddgkkkriikpvreki
gdytsvgtrkqpnleeisklkpdliiadssrhkginkelnkiaptlslksfdgdykqnin
sfktiakalnkekegekrlaehdklinkykdeikfdrnqkvlpavvakagllahpnysyv
gqflnelgfknalsddvtkglskylkgpylqldtehladlnpermiimtdhakkdsaefk
klqedatwkklnavknnrvdivdrdvwarsrglisseemakelvelsk

SCOPe Domain Coordinates for d3li2a_:

Click to download the PDB-style file with coordinates for d3li2a_.
(The format of our PDB-style files is described here.)

Timeline for d3li2a_: