Lineage for d3lh2i_ (3lh2 I:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.0: automated matches [191470] (1 protein)
not a true familyProtein automated matches [190740] (26 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries) 
Domain d3lh2i_: 3lh2 I: [212878]
automated match to d3ebaa_
Details for d3lh2i_
PDB Entry: 3lh2 (more details), 2.65 Å
PDB Description: Crystal structure of HIV epitope-scaffold 4E10_1VI7A_S0_002_N 4E10 Fv complex
PDB Compounds: (I:) Fv 4E10 heavy chainSCOPe Domain Sequences for d3lh2i_:
Sequence, based on SEQRES records: (download)
>d3lh2i_ b.1.1.0 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltitnya
prfqgrititadrststaylelnslrpedtavyycaregttgagwlgkpigafahwgqgt
lvtvsslehhhh
Sequence, based on observed residues (ATOM records): (download)
>d3lh2i_ b.1.1.0 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltitnya
prfqgrititadrststaylelnslrpedtavyycaregttgkpigafahwgqgtlvtvs
slehhhh
SCOPe Domain Coordinates for d3lh2i_:
Click to download the PDB-style file with coordinates for d3lh2i_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3lh2i_:
- d3lh2i_ first appeared in SCOPe 2.03
- d3lh2i_ appears in SCOPe 2.04
- d3lh2i_ is called d3lh2i1 in SCOPe 2.06
- d3lh2i_ appears in the current release, SCOPe 2.08, called d3lh2i1
View in 3D
