Lineage for d3leab_ (3lea B:)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies)
contains mixed beta sheet with connection over free side of the sheetSuperfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) 
Family d.92.1.10: TNF-alpha converting enzyme, TACE, catalytic domain [55525] (2 proteins)
automatically mapped to Pfam PF13574
automatically mapped to Pfam PF13583Protein TNF-alpha converting enzyme, TACE, catalytic domain [55526] (1 species) Species Human (Homo sapiens) [TaxId:9606] [55527] (20 PDB entries) 
Domain d3leab_: 3lea B: [180224]
automated match to d1bkce_
complexed with ipa, z93, zn
Details for d3leab_
PDB Entry: 3lea (more details), 2 Å
PDB Description: crystal structure of the catalytic domain of tace with isoindolinone- biphenyl-hydantoin inhibitor
PDB Compounds: (B:) Disintegrin and metalloproteinase domain-containing protein 17SCOPe Domain Sequences for d3leab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3leab_ d.92.1.10 (B:) TNF-alpha converting enzyme, TACE, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
radpdpmkntckllvvadhrfyrymgrgeestttnylielidrvddiyrntawdnagfkg
ygiqieqirilkspqevkpgekhynmaksypneekdawdvkmlleqfsfdiaeeaskvcl
ahlftyqdfdmgtlglayggspranshggvcpkayyspvgkkniylnsgltstknygkti
ltkeadlvtthelghnfgaehdpdglaecapnedqggkyvmypiavsgdhennkmfsqcs
kqsiyktieskaqecfqersn
SCOPe Domain Coordinates for d3leab_:
Click to download the PDB-style file with coordinates for d3leab_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3leab_:
- d3leab_ first appeared in SCOPe 2.01
- d3leab_ appears in SCOPe 2.05
- d3leab_ appears in SCOPe 2.07
- d3leab_ appears in the current release, SCOPe 2.08
View in 3D
