Lineage for d3lb2a_ (3lb2 A:)
- Root: SCOPe 2.04
Class a: All alpha proteins [46456] (285 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies)
core: 6 helices; folded leaf, partly openedSuperfamily a.1.1: Globin-like [46458] (5 families) 
Family a.1.1.2: Globins [46463] (27 proteins)
Heme-binding protein
Protein Dehaloperoxidase [46530] (1 species) Species Amphitrite ornata [TaxId:129555] [46531] (31 PDB entries) 
Domain d3lb2a_: 3lb2 A: [180152]
automated match to d1ew6a_
complexed with bml, hem, so4
Details for d3lb2a_
PDB Entry: 3lb2 (more details), 1.06 Å
PDB Description: Two-site competitive inhibition in dehaloperoxidase-hemoglobin
PDB Compounds: (A:) Dehaloperoxidase ASCOPe Domain Sequences for d3lb2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lb2a_ a.1.1.2 (A:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk
SCOPe Domain Coordinates for d3lb2a_:
Click to download the PDB-style file with coordinates for d3lb2a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3lb2a_:
- d3lb2a_ first appeared in SCOPe 2.01
- d3lb2a_ appears in SCOPe 2.03
- d3lb2a_ appears in SCOPe 2.05
- d3lb2a_ appears in the current release, SCOPe 2.08
View in 3D
