Lineage for d3l9cb_ (3l9c B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2444581Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2444582Protein automated matches [190115] (91 species)
    not a true protein
  7. 2445255Species Streptococcus mutans [TaxId:210007] [226048] (1 PDB entry)
  8. 2445257Domain d3l9cb_: 3l9c B: [212761]
    Other proteins in same PDB: d3l9ca2
    automated match to d3m7wa_

Details for d3l9cb_

PDB Entry: 3l9c (more details), 1.6 Å

PDB Description: The Crystal Structure of smu.777 from Streptococcus mutans UA159
PDB Compounds: (B:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d3l9cb_:

Sequence, based on SEQRES records: (download)

>d3l9cb_ c.1.10.0 (B:) automated matches {Streptococcus mutans [TaxId: 210007]}
mkivvpvmpqnieeanqldltridstdiiewradylvkddiltvapaifekfsghevift
lrtekeggnislsnedylaiirdiaalyqpdyidfeyfsyrdvleemydfsnlilsyhnf
eetpenlmevfseltalaprvvkiavmpkneqdvldlmnytrgfktlnpnqeyvtmsmsk
lgrisrlaadligsswtfasleqesapgqisladmrkikevld

Sequence, based on observed residues (ATOM records): (download)

>d3l9cb_ c.1.10.0 (B:) automated matches {Streptococcus mutans [TaxId: 210007]}
mkivvpvmpqnieeanqldltridstdiiewradylvkddiltvapaifekfsghevift
lrtekeggnislsnedylaiirdiaalyqpdyidfeyfsyrdvleemydfsnlilsyhnf
eetpenlmevfseltalaprvvkiavmpkneqdvldlmnytrgfktlnpnqeyvtmsmsk
lgrisrlaadligsswtfasleqapgqisladmrkikevld

SCOPe Domain Coordinates for d3l9cb_:

Click to download the PDB-style file with coordinates for d3l9cb_.
(The format of our PDB-style files is described here.)

Timeline for d3l9cb_: