Lineage for d3l78a_ (3l78 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133575Family c.47.1.12: ArsC-like [69518] (4 proteins)
    Pfam PF03960
  6. 2133588Protein automated matches [190780] (3 species)
    not a true protein
  7. 2133600Species Streptococcus mutans [TaxId:210007] [189553] (1 PDB entry)
  8. 2133601Domain d3l78a_: 3l78 A: [180042]
    automated match to d1z3ea1

Details for d3l78a_

PDB Entry: 3l78 (more details), 1.9 Å

PDB Description: The crystal structure of SMU.1142C from Streptococcus mutans UA159
PDB Compounds: (A:) Regulatory protein spx

SCOPe Domain Sequences for d3l78a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l78a_ c.47.1.12 (A:) automated matches {Streptococcus mutans [TaxId: 210007]}
mvtlflspsctscrkarawlnrhdvvfqehnimtsplsrdellkilsytengtediistr
skvfqkldidvdelsvselinlisknpsllrrpiimdnkrmqigfnedeiraflprd

SCOPe Domain Coordinates for d3l78a_:

Click to download the PDB-style file with coordinates for d3l78a_.
(The format of our PDB-style files is described here.)

Timeline for d3l78a_: