Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.12: ArsC-like [69518] (4 proteins) Pfam PF03960 |
Protein automated matches [190780] (3 species) not a true protein |
Species Streptococcus mutans [TaxId:210007] [189553] (1 PDB entry) |
Domain d3l78a_: 3l78 A: [180042] automated match to d1z3ea1 |
PDB Entry: 3l78 (more details), 1.9 Å
SCOPe Domain Sequences for d3l78a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l78a_ c.47.1.12 (A:) automated matches {Streptococcus mutans [TaxId: 210007]} mvtlflspsctscrkarawlnrhdvvfqehnimtsplsrdellkilsytengtediistr skvfqkldidvdelsvselinlisknpsllrrpiimdnkrmqigfnedeiraflprd
Timeline for d3l78a_: