Lineage for d3l5oa_ (3l5o A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
Superfamily c.67.3: Dhaf3308-like [159713] (1 family) 
not known to bind PLP cofactor; the extra N-terminal subdomain has a enolase N-terminal domain-like fold (54825)Family c.67.3.1: Dhaf3308-like [159714] (1 protein)
Pfam PF04016; DUF364Protein Hypothetical protein Dhaf_3308 [159715] (1 species) Species Desulfitobacterium hafniense [TaxId:49338] [159716] (1 PDB entry)
Uniprot Q18YZ7 1-251
Domain d3l5oa_: 3l5o A: [179967]
complexed with cl, edo, imd
Details for d3l5oa_
PDB Entry: 3l5o (more details), 2.01 Å
PDB Description: crystal structure of protein with unknown function from duf364 family (zp_00559375.1) from desulfitobacterium hafniense dcb-2 at 2.01 a resolution
PDB Compounds: (A:) uncharacterized protein from DUF364 familySCOPe Domain Sequences for d3l5oa_:
Sequence, based on SEQRES records: (download)
>d3l5oa_ c.67.3.1 (A:) Hypothetical protein Dhaf_3308 {Desulfitobacterium hafniense [TaxId: 49338]}
fqgmweiydamingipedflvdelvcgtthsvirsgngvglgpnrpfetrmpmltqnllg
lplrvaagcvkswnyveasiglaainayynnpqvarehgvifsdakrvedrmndpfimsq
nevkgkkvgvvghfphlesllepicdlsilewspeegdyplpasefilpecdyvyitcas
vvdktlprllelsrnarritlvgpgtplapvlfehglqelsgfmvkdnarafrivagaek
vkiysagqkvtikk
Sequence, based on observed residues (ATOM records): (download)
>d3l5oa_ c.67.3.1 (A:) Hypothetical protein Dhaf_3308 {Desulfitobacterium hafniense [TaxId: 49338]}
fqgmweiydamingipedflvdelvcgtthsvirsgngvglgpnrpfetrmpmltqnllg
lplrvaagcvkswnyveasiglaainayynnpqvarehgvifsdandpfimsqnevkgkk
vgvvghfphlesllepicdlsilewspeegdyplpasefilpecdyvyitcasvvdktlp
rllelsrnarritlvgpgtplapvlfehglqelsgfmvkdnarafrivagaekvkiysag
qkvtikk
SCOPe Domain Coordinates for d3l5oa_:
Click to download the PDB-style file with coordinates for d3l5oa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3l5oa_:
- d3l5oa_ first appeared in SCOPe 2.01
- d3l5oa_ appears in SCOPe 2.04
- d3l5oa_ is called d3l5oa1 in SCOPe 2.06
- d3l5oa_ appears in the current release, SCOPe 2.08, called d3l5oa1
View in 3D
