Lineage for d3l55a_ (3l55 A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.0: automated matches [191314] (1 protein)
not a true familyProtein automated matches [190075] (132 species)
not a true protein
Species Prevotella bryantii [TaxId:77095] [276992] (6 PDB entries) 
Domain d3l55a_: 3l55 A: [305788]
automated match to d5d9na_
complexed with ca, na
Details for d3l55a_
PDB Entry: 3l55 (more details), 1.6 Å
PDB Description: Crystal structure of a putative beta-1,4-endoglucanase / cellulase from Prevotella bryantii
PDB Compounds: (A:) B-1,4-endoglucanase/cellulaseSCOPe Domain Sequences for d3l55a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l55a_ c.1.8.0 (A:) automated matches {Prevotella bryantii [TaxId: 77095]}
ymeesaqsavdnfglgfnlgntldangcgtgkpvatyetfwgqpettqdmmtflmqngfn
avripvtwyehmdaegnvdeawmmrvkaiveyamnaglyaivnvhhdtaagsgawikadt
dvyaatkekfkklwtqianaladydqhllfegynemldgnnswdepqkasgyealnnyaq
dfvdavratggnnatrnlivntyaaakgenvlnnfmlptdavnnhlivqvhsydpwnffn
tkttwdsechntlteifsalskkfttipyiigeygthgesdisvsksspaekiklaadqa
admvklakdhhsatfywmsifdgsdriqpqwslptvveamqeayn
SCOPe Domain Coordinates for d3l55a_:
Click to download the PDB-style file with coordinates for d3l55a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3l55a_:
- d3l55a_ first appeared in SCOPe 2.06
- d3l55a_ appears in SCOPe 2.07
View in 3D
