Lineage for d3l3ua_ (3l3u A:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the restSuperfamily c.55.3: Ribonuclease H-like [53098] (16 families) 
consists of one domain of this fold
Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins) Protein Retroviral integrase, catalytic domain [53108] (4 species) 
Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (73 PDB entries) 
Domain d3l3ua_: 3l3u A: [236775]
automated match to d3ao1a_
complexed with so4
Details for d3l3ua_
PDB Entry: 3l3u (more details), 1.4 Å
PDB Description: crystal structure of the hiv-1 integrase core domain to 1.4a
PDB Compounds: (A:) Pol polyproteinSCOPe Domain Sequences for d3l3ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l3ua_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacdwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnhkrkggiggysagerivdiiatd
SCOPe Domain Coordinates for d3l3ua_:
Click to download the PDB-style file with coordinates for d3l3ua_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3l3ua_:
- d3l3ua_ first appeared in SCOPe 2.03
- d3l3ua_ appears in SCOPe 2.06
- d3l3ua_ appears in the current release, SCOPe 2.08
View in 3D
