Lineage for d3l21a_ (3l21 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834988Protein automated matches [190095] (28 species)
    not a true protein
  7. 2835192Species Mycobacterium tuberculosis [TaxId:1773] [189568] (1 PDB entry)
  8. 2835193Domain d3l21a_: 3l21 A: [179863]
    automated match to d1xxxa1
    complexed with act, bme, cl, gol, pyr, so4; mutant

Details for d3l21a_

PDB Entry: 3l21 (more details), 2.1 Å

PDB Description: the crystal structure of a dimeric mutant of dihydrodipicolinate synthase (dapa, rv2753c) from mycobacterium tuberculosis - dhdps- a204r
PDB Compounds: (A:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3l21a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l21a_ c.1.10.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
vgfdvaarlgtlltamvtpfsgdgsldtataarlanhlvdqgcdglvvsgttgesptttd
gekiellravleavgdrarviagagtydtahsirlakacaaegahgllvvtpyyskppqr
glqahftavadatelpmllydipgrsavpiepdtiralashpnivgvxdakadlhsgaqi
madtglayysgddalnlpwlrmgatgfisviahlaagqlrellsafgsgdiatarkinia
vaplcnamsrlggvtlskaglrlqgidvgdprlpqvaatpeqidalaadmraasvlr

SCOPe Domain Coordinates for d3l21a_:

Click to download the PDB-style file with coordinates for d3l21a_.
(The format of our PDB-style files is described here.)

Timeline for d3l21a_: