Lineage for d3l0la_ (3l0l A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. Protein automated matches [191142] (5 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [189274] (121 PDB entries)
  8. Domain d3l0la_: 3l0l A: [179842]
    automated match to d1n83a_
    protein/DNA complex; complexed with hc3

Details for d3l0la_

PDB Entry: 3l0l (more details), 1.7400000000000002 Å

PDB Description: crystal structure of orphan nuclear receptor rorgamma in complex with natural ligand
PDB Compounds: (A:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d3l0la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l0la_ a.123.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eapyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwerc
ahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffeg
kyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkve
qlqynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpp
lykelfs

SCOPe Domain Coordinates for d3l0la_ are not available.

Timeline for d3l0la_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3l0lb_