Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.116: alpha/beta knot [75216] (1 superfamily) core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot |
Superfamily c.116.1: alpha/beta knot [75217] (9 families) known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily all known members have dimeric structures |
Family c.116.1.0: automated matches [191557] (1 protein) not a true family |
Protein automated matches [190961] (22 species) not a true protein |
Species Staphylococcus aureus [TaxId:282458] [189168] (1 PDB entry) |
Domain d3ky7a_: 3ky7 A: [179805] automated match to d1uaja_ |
PDB Entry: 3ky7 (more details), 2.35 Å
SCOPe Domain Sequences for d3ky7a_:
Sequence, based on SEQRES records: (download)
>d3ky7a_ c.116.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 282458]} mkidyltlfpemfdgvlnhsimkraqennklqintvnfrdyainkhnqvddypygggqgm vlkpepvfnamedldvteqarvilmcpqgepfshqkavelskadhivficghyegyderi rthlvtdeismgdyvltggelpamtmtdaivrlipgvlgneqshqddsfsdgllefpqyt rprefkgltvpdvllsgnhanidawrheqklirtynkrpdliekypltnadkqileryki glk
>d3ky7a_ c.116.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 282458]} mkidyltlfpemfdgvlnhsimkraqennklqintvnfrdyankhnqvddypygggqgmv lkpepvfnamedldvteqarvilmcpqgepfshqkavelskadhivficghyegyderir thlvtdeismgdyvltggelpamtmtdaivrlipgsdgllefpqytrprefkgltvpdvl lsgnhanidawrheqklirtynkrpdliekypltnadkqilerykiglk
Timeline for d3ky7a_: