Lineage for d3ky7a_ (3ky7 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921212Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 2921213Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 2921420Family c.116.1.0: automated matches [191557] (1 protein)
    not a true family
  6. 2921421Protein automated matches [190961] (22 species)
    not a true protein
  7. 2921614Species Staphylococcus aureus [TaxId:282458] [189168] (1 PDB entry)
  8. 2921615Domain d3ky7a_: 3ky7 A: [179805]
    automated match to d1uaja_

Details for d3ky7a_

PDB Entry: 3ky7 (more details), 2.35 Å

PDB Description: 2.35 angstrom resolution crystal structure of a putative trna (guanine-7-)-methyltransferase (trmd) from staphylococcus aureus subsp. aureus mrsa252
PDB Compounds: (A:) tRNA (guanine-N(1)-)-methyltransferase

SCOPe Domain Sequences for d3ky7a_:

Sequence, based on SEQRES records: (download)

>d3ky7a_ c.116.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 282458]}
mkidyltlfpemfdgvlnhsimkraqennklqintvnfrdyainkhnqvddypygggqgm
vlkpepvfnamedldvteqarvilmcpqgepfshqkavelskadhivficghyegyderi
rthlvtdeismgdyvltggelpamtmtdaivrlipgvlgneqshqddsfsdgllefpqyt
rprefkgltvpdvllsgnhanidawrheqklirtynkrpdliekypltnadkqileryki
glk

Sequence, based on observed residues (ATOM records): (download)

>d3ky7a_ c.116.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 282458]}
mkidyltlfpemfdgvlnhsimkraqennklqintvnfrdyankhnqvddypygggqgmv
lkpepvfnamedldvteqarvilmcpqgepfshqkavelskadhivficghyegyderir
thlvtdeismgdyvltggelpamtmtdaivrlipgsdgllefpqytrprefkgltvpdvl
lsgnhanidawrheqklirtynkrpdliekypltnadkqilerykiglk

SCOPe Domain Coordinates for d3ky7a_:

Click to download the PDB-style file with coordinates for d3ky7a_.
(The format of our PDB-style files is described here.)

Timeline for d3ky7a_: