Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.17: RNA Helicase C-terminal domain-like [345961] (1 protein) Pfam PF07717; contains additional helices |
Protein Pre-mRNA splicing factor DEAH RNA helicase Prp43 [346051] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [346241] (2 PDB entries) |
Domain d3kx2a5: 3kx2 A:635-755 [344900] Other proteins in same PDB: d3kx2a1, d3kx2a2, d3kx2a3, d3kx2a4, d3kx2b1, d3kx2b2, d3kx2b3, d3kx2b4 protein/RNA complex; complexed with adp, mg |
PDB Entry: 3kx2 (more details), 2.2 Å
SCOPe Domain Sequences for d3kx2a5:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kx2a5 b.40.4.17 (A:635-755) Pre-mRNA splicing factor DEAH RNA helicase Prp43 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} nttdyespkyfdnirkalasgffmqvakkrsgakgyitvkdnqdvlihpstvlghdaewv iynefvltsknyirtvtsvrpewlieiapayydlsnfqkgdvklslerikekvdrlnelk q
Timeline for d3kx2a5: