Lineage for d3kx2a5 (3kx2 A:635-755)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2790404Family b.40.4.17: RNA Helicase C-terminal domain-like [345961] (1 protein)
    Pfam PF07717; contains additional helices
  6. 2790405Protein Pre-mRNA splicing factor DEAH RNA helicase Prp43 [346051] (1 species)
  7. 2790406Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [346241] (2 PDB entries)
  8. 2790407Domain d3kx2a5: 3kx2 A:635-755 [344900]
    Other proteins in same PDB: d3kx2a1, d3kx2a2, d3kx2a3, d3kx2a4, d3kx2b1, d3kx2b2, d3kx2b3, d3kx2b4
    protein/RNA complex; complexed with adp, mg

Details for d3kx2a5

PDB Entry: 3kx2 (more details), 2.2 Å

PDB Description: crystal structure of prp43p in complex with adp
PDB Compounds: (A:) Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43

SCOPe Domain Sequences for d3kx2a5:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kx2a5 b.40.4.17 (A:635-755) Pre-mRNA splicing factor DEAH RNA helicase Prp43 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
nttdyespkyfdnirkalasgffmqvakkrsgakgyitvkdnqdvlihpstvlghdaewv
iynefvltsknyirtvtsvrpewlieiapayydlsnfqkgdvklslerikekvdrlnelk
q

SCOPe Domain Coordinates for d3kx2a5:

Click to download the PDB-style file with coordinates for d3kx2a5.
(The format of our PDB-style files is described here.)

Timeline for d3kx2a5: