![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
![]() | Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
![]() | Family d.113.1.0: automated matches [191580] (1 protein) not a true family |
![]() | Protein automated matches [191036] (16 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225626] (4 PDB entries) |
![]() | Domain d3kvha_: 3kvh A: [212552] automated match to d1u20a1 complexed with cl, gol |
PDB Entry: 3kvh (more details), 1.7 Å
SCOPe Domain Sequences for d3kvha_:
Sequence, based on SEQRES records: (download)
>d3kvha_ d.113.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lkqisrveamrlgpgwshschamlyaanpgqlfgripmrfsvlmqmrfdgllgfpggfvd rrfwsledglnrvlglglgclrlteadylsshltegphrvvahlyarqltleqlhaveis avhsrdhglevlglvrvplytqkdrvggfpnflsnafvstakcqllfalkvlnmmpeekl vealaaatekqkkalekll
>d3kvha_ d.113.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lkqisrveamrlgpgwshschamlyaanpgqlfgripmrfsvlmqmrfdgllgfpggfvd rrfwsledglnrvlglglrlteadylsshltrvvahlyarqltleqlhaveisavhsrdh glevlglvrvplytqkdrvggfpnflsnafvstakcqllfalkvlnmmpeeklvealaaa tekqkkalekll
Timeline for d3kvha_: