Lineage for d3kvha_ (3kvh A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. Family d.113.1.0: automated matches [191580] (1 protein)
    not a true family
  6. Protein automated matches [191036] (17 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [225626] (39 PDB entries)
  8. Domain d3kvha_: 3kvh A: [212552]
    automated match to d1u20a1
    complexed with cl, gol

Details for d3kvha_

PDB Entry: 3kvh (more details), 1.7000000000000002 Å

PDB Description: crystal structure of human protein syndesmos (nudt16-like protein)
PDB Compounds: (A:) Protein syndesmos

SCOPe Domain Sequences for d3kvha_:

Sequence, based on SEQRES records: (download)

>d3kvha_ d.113.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lkqisrveamrlgpgwshschamlyaanpgqlfgripmrfsvlmqmrfdgllgfpggfvd
rrfwsledglnrvlglglgclrlteadylsshltegphrvvahlyarqltleqlhaveis
avhsrdhglevlglvrvplytqkdrvggfpnflsnafvstakcqllfalkvlnmmpeekl
vealaaatekqkkalekll

Sequence, based on observed residues (ATOM records): (download)

>d3kvha_ d.113.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lkqisrveamrlgpgwshschamlyaanpgqlfgripmrfsvlmqmrfdgllgfpggfvd
rrfwsledglnrvlglglrlteadylsshltrvvahlyarqltleqlhaveisavhsrdh
glevlglvrvplytqkdrvggfpnflsnafvstakcqllfalkvlnmmpeeklvealaaa
tekqkkalekll

SCOPe Domain Coordinates for d3kvha_ are not available.

Timeline for d3kvha_: