Lineage for d3kk8a_ (3kk8 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2984752Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2984753Protein automated matches [190417] (37 species)
    not a true protein
  7. 2987319Species Nematode (Caenorhabditis elegans) [TaxId:6239] [225832] (2 PDB entries)
  8. 2987322Domain d3kk8a_: 3kk8 A: [212400]
    automated match to d3bhhd_
    complexed with mg

Details for d3kk8a_

PDB Entry: 3kk8 (more details), 1.72 Å

PDB Description: camkii substrate complex a
PDB Compounds: (A:) Calcium/calmodulin dependent protein kinase II

SCOPe Domain Sequences for d3kk8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kk8a_ d.144.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
stkfsdnydvkeelgkgafsvvrrcvhkttglefaakiintkklsardfqklerearicr
klqhpnivrlhdsiqeesfhylvfdlvtggelfedivarefyseadashciqqilesiay
chsngivhrnlkpenlllaskakgaavkladfglaievndseawhgfagtpgylspevlk
kdpyskpvdiwacgvilyillvgyppfwdedqhrlyaqikagaydypspewdtvtpeaks
lidsmltvnpkkritadqalkvpwicnrervasaihrqdtvdcl

SCOPe Domain Coordinates for d3kk8a_:

Click to download the PDB-style file with coordinates for d3kk8a_.
(The format of our PDB-style files is described here.)

Timeline for d3kk8a_: