Lineage for d3kiva_ (3kiv A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033267Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 3033268Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 3033269Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 3033270Protein Apolipoprotein A [57455] (3 species)
  7. 3033271Species Human (Homo sapiens), IV-10/M66 variant [TaxId:9606] [57456] (3 PDB entries)
  8. 3033272Domain d3kiva_: 3kiv A: [44660]
    complexed with aca

Details for d3kiva_

PDB Entry: 3kiv (more details), 1.8 Å

PDB Description: recombinant kringle iv-10/m66 variant of human apolipoprotein(a)
PDB Compounds: (A:) apolipoprotein

SCOPe Domain Sequences for d3kiva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kiva_ g.14.1.1 (A:) Apolipoprotein A {Human (Homo sapiens), IV-10/M66 variant [TaxId: 9606]}
qcyhgngqsyrgtfsttvtgrtcqswssmtphrhqrtpenypndgltmnycrnpdadtgp
wcfttdpsirweycnltrc

SCOPe Domain Coordinates for d3kiva_:

Click to download the PDB-style file with coordinates for d3kiva_.
(The format of our PDB-style files is described here.)

Timeline for d3kiva_: