Lineage for d3kfda_ (3kfd A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033576Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 3033577Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 3033672Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins)
  6. 3033739Protein TGF-beta1 [57512] (1 species)
  7. 3033740Species Human (Homo sapiens) [TaxId:9606] [57513] (6 PDB entries)
  8. 3033741Domain d3kfda_: 3kfd A: [247150]
    Other proteins in same PDB: d3kfde_, d3kfdf_, d3kfdg_, d3kfdh_
    automated match to d1klca_

Details for d3kfda_

PDB Entry: 3kfd (more details), 3 Å

PDB Description: Ternary complex of TGF-b1 reveals isoform-specific ligand recognition and receptor recruitment in the superfamily
PDB Compounds: (A:) Transforming growth factor beta-1

SCOPe Domain Sequences for d3kfda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kfda_ g.17.1.2 (A:) TGF-beta1 {Human (Homo sapiens) [TaxId: 9606]}
aldtnycfssteknccvrqlyidfrkdlgwkwihepkgyhanfclgpcpyiwsldtqysk
vlalynqhnpgasaapccvpqaleplpivyyvgrkpkveqlsnmivrsckcs

SCOPe Domain Coordinates for d3kfda_:

Click to download the PDB-style file with coordinates for d3kfda_.
(The format of our PDB-style files is described here.)

Timeline for d3kfda_: