Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
Protein automated matches [190459] (41 species) not a true protein |
Species Burkholderia pseudomallei [TaxId:320372] [189579] (2 PDB entries) |
Domain d3k9wa_: 3k9w A: [212254] automated match to d3pxua_ complexed with 4ps, act, ade, pg4, so4 |
PDB Entry: 3k9w (more details), 1.6 Å
SCOPe Domain Sequences for d3k9wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k9wa_ c.26.1.0 (A:) automated matches {Burkholderia pseudomallei [TaxId: 320372]} gsmvvavypgtfdpltrghedlvrrassifdtlvvgvadsrakkpffsleerlkianevl ghypnvkvmgftgllkdfvrandarvivrglravsdfeyefqmagmnryllpdvetmfmt psdqyqfisgtivreiaqlggdvskfvfpsvekwltekvaama
Timeline for d3k9wa_: