Lineage for d3k9va_ (3k9v A:)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.104: Cytochrome P450 [48263] (1 superfamily)
multihelicalSuperfamily a.104.1: Cytochrome P450 [48264] (2 families) 
Family a.104.1.0: automated matches [191509] (1 protein)
not a true familyProtein automated matches [190847] (95 species)
not a true protein
Species Norway rat (Rattus norvegicus) [TaxId:10116] [267845] (2 PDB entries) 
Domain d3k9va_: 3k9v A: [264967]
automated match to d3t3qa_
complexed with cps, hem
Details for d3k9va_
PDB Entry: 3k9v (more details), 2.5 Å
PDB Description: crystal structure of rat mitochondrial p450 24a1 s57d in complex with chaps
PDB Compounds: (A:) 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrialSCOPe Domain Sequences for d3k9va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k9va_ a.104.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
etrnvtdlpgptnwpllgslleifwkgglkkqhdtlaeyhkkygqifrmklgsfdsvhlg
spsllealyrtesahpqrleikpwkayrdhrneayglmilegqewqrvrsafqkklmkpv
eimkldkkinevladflermdelcdergripdlyselnkwsfesiclvlyekrfgllqke
teeealtfitaiktmmstfgkmmvtpvelhkrlntkvwqahtlawdtifksvkpcidnrl
qrysqqpgadflcdiyqqdhlskkelyaavtelqlaavettanslmwilynlsrnpqaqr
rllqevqsvlpdnqtpraedlrnmpylkaclkesmrltpsvpfttrtldkptvlgeyalp
kgtvltlntqvlgssednfedshkfrperwlqkekkinpfahlpfgigkrmcigrrlael
qlhlalcwiiqkydivatdnepvemlhlgilvpsrelpiafrpr
SCOPe Domain Coordinates for d3k9va_:
Click to download the PDB-style file with coordinates for d3k9va_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3k9va_:
- d3k9va_ first appeared in SCOPe 2.05
- d3k9va_ appears in SCOPe 2.06
- d3k9va_ appears in the current release, SCOPe 2.08
View in 3D
