Lineage for d3k1eb_ (3k1e B:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.39: EF Hand-like [47472] (4 superfamilies)
core: 4 helices; array of 2 hairpins, opened
Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) 
the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
Family a.39.2.0: automated matches [191595] (1 protein)
not a true familyProtein automated matches [191085] (10 species)
not a true protein
Species Yellow fever mosquito (Aedes aegypti) [TaxId:7159] [189159] (1 PDB entry) 
Domain d3k1eb_: 3k1e B: [178948]
automated match to d1r5ra_
complexed with cl, mg, peu
Details for d3k1eb_
PDB Entry: 3k1e (more details), 1.85 Å
PDB Description: Crystal structure of odorant binding protein 1 (AaegOBP1) from Aedes aegypti
PDB Compounds: (B:) odorant binding proteinSCOPe Domain Sequences for d3k1eb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k1eb_ a.39.2.0 (B:) automated matches {Yellow fever mosquito (Aedes aegypti) [TaxId: 7159]}
ypppefleamkplreicikktgvteeaiiefsdgkvhedenlkcymnclfheakvvddtg
hvhleklhdalpdsmhdialhmgkrclypegenlcekafwlhkcwkesdpkhyfli
SCOPe Domain Coordinates for d3k1eb_:
Click to download the PDB-style file with coordinates for d3k1eb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3k1eb_:
- d3k1eb_ first appeared in SCOPe 2.01
- d3k1eb_ appears in SCOPe 2.07
View in 3D
