Lineage for d3ju8a_ (3ju8 A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.82: ALDH-like [53719] (1 superfamily)
consists of two similar domains with 3 layers (a/b/a) each; duplication
core: parallel beta-sheet of 5 strands, order 32145Superfamily c.82.1: ALDH-like [53720] (3 families) 
binds NAD differently from other NAD(P)-dependent oxidoreductasesFamily c.82.1.0: automated matches [191448] (1 protein)
not a true familyProtein automated matches [190683] (38 species)
not a true protein
Species Pseudomonas aeruginosa [TaxId:287] [225751] (7 PDB entries) 
Domain d3ju8a_: 3ju8 A: [232640]
automated match to d3jz4d_
complexed with cl, gol, mg, nad, sin, so4
Details for d3ju8a_
PDB Entry: 3ju8 (more details), 1.82 Å
PDB Description: Crystal Structure of Succinylglutamic Semialdehyde Dehydrogenase from Pseudomonas aeruginosa.
PDB Compounds: (A:) Succinylglutamic semialdehyde dehydrogenaseSCOPe Domain Sequences for d3ju8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ju8a_ c.82.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mmsthyiagqwlagqgetlesldpvgqgvvwsgrgadatqvdaavcaareafpawarrpl
eqriellerfaatlksradelarvigeetgkplwesatevtsmvnkvaisvqafrertge
ksgpladatavlrhkphgvvavfgpynfpghlpnghivpallagncvvfkpseltpkvae
ltlkawiqaglpagvlnlvqggretgvalaahrgldglfftgssrtgnllhsqfggqpqk
ilalemggnnplvveevadldaavytiiqsafisagqrctcarrllvpqgawgdallarl
vavsatlrvgrfdeqpapfmgavislsaaehllkaqehligkgaqpllamtqpidgaall
tpgildvsavaerpdeeffgpllqvirysdfaaaireanatqyglaagllsdsrerfeqf
lvesragivnwnkqltgaassapfggigasgnhrpsayyaadycaypvaslespsvslpa
tltpgi
SCOPe Domain Coordinates for d3ju8a_:
Click to download the PDB-style file with coordinates for d3ju8a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3ju8a_:
- d3ju8a_ first appeared in SCOPe 2.03
- d3ju8a_ appears in SCOPe 2.04
- d3ju8a_ is called d3ju8a1 in SCOPe 2.06
- d3ju8a_ appears in the current release, SCOPe 2.08, called d3ju8a1
View in 3D
