Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
Protein automated matches [190683] (38 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [225751] (7 PDB entries) |
Domain d3ju8a_: 3ju8 A: [232640] automated match to d3jz4d_ complexed with cl, gol, mg, nad, sin, so4 |
PDB Entry: 3ju8 (more details), 1.82 Å
SCOPe Domain Sequences for d3ju8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ju8a_ c.82.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} mmsthyiagqwlagqgetlesldpvgqgvvwsgrgadatqvdaavcaareafpawarrpl eqriellerfaatlksradelarvigeetgkplwesatevtsmvnkvaisvqafrertge ksgpladatavlrhkphgvvavfgpynfpghlpnghivpallagncvvfkpseltpkvae ltlkawiqaglpagvlnlvqggretgvalaahrgldglfftgssrtgnllhsqfggqpqk ilalemggnnplvveevadldaavytiiqsafisagqrctcarrllvpqgawgdallarl vavsatlrvgrfdeqpapfmgavislsaaehllkaqehligkgaqpllamtqpidgaall tpgildvsavaerpdeeffgpllqvirysdfaaaireanatqyglaagllsdsrerfeqf lvesragivnwnkqltgaassapfggigasgnhrpsayyaadycaypvaslespsvslpa tltpgi
Timeline for d3ju8a_: