Lineage for d3js2a_ (3js2 A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPKFamily d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
members organized in the groups and subfamiles specified by the comments
Protein Fibroblast growth factor receptor 1 [56158] (1 species)
PTK group; FGFR subfamily; membrane spanning protein tyrosine kinaseSpecies Human (Homo sapiens) [TaxId:9606] [56159] (47 PDB entries) 
Domain d3js2a_: 3js2 A: [178748]
automated match to d1agwb_
complexed with po4, vm1
Details for d3js2a_
PDB Entry: 3js2 (more details), 2.2 Å
PDB Description: crystal structure of minimal kinase domain of fibroblast growth factor receptor 1 in complex with 5-(2-thienyl)nicotinic acid
PDB Compounds: (A:) Basic fibroblast growth factor receptor 1SCOPe Domain Sequences for d3js2a_:
Sequence, based on SEQRES records: (download)
>d3js2a_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]}
elpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksdatek
dlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppgley
synpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfg
lardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypg
vpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsn
qe
Sequence, based on observed residues (ATOM records): (download)
>d3js2a_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]}
elpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksdatek
dlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppglhn
peeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglardihh
idyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypgvpveelf
kllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsnqe
SCOPe Domain Coordinates for d3js2a_:
Click to download the PDB-style file with coordinates for d3js2a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3js2a_:
- d3js2a_ first appeared in SCOPe 2.01
- d3js2a_ appears in SCOPe 2.07
View in 3D
