Class b: All beta proteins [48724] (180 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.1: Elongation factors [50448] (11 proteins) |
Protein Pre-mRNA splicing factor Cwf10, domain II [346053] (1 species) |
Species Schizosaccharomyces pombe 972h- [TaxId:284812] [346245] (1 PDB entry) |
Domain d3jb9b2: 3jb9 B:452-595 [344798] Other proteins in same PDB: d3jb9a1, d3jb9a2, d3jb9a3, d3jb9a4, d3jb9a5, d3jb9b1, d3jb9b3, d3jb9b4, d3jb9b5, d3jb9c_, d3jb9e_, d3jb9f_, d3jb9g_, d3jb9h_, d3jb9i_, d3jb9j_, d3jb9k_, d3jb9l_, d3jb9m_, d3jb9r_, d3jb9s1, d3jb9s2, d3jb9t1, d3jb9t2, d3jb9u1, d3jb9u2, d3jb9u3, d3jb9v1, d3jb9v2, d3jb9w_, d3jb9x1, d3jb9x2, d3jb9x3, d3jb9x4, d3jb9y1, d3jb9y2, d3jb9z_ protein/RNA complex; complexed with adp, gdp, mg, zn |
PDB Entry: 3jb9 (more details), 3.6 Å
SCOPe Domain Sequences for d3jb9b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jb9b2 b.43.3.1 (B:452-595) Pre-mRNA splicing factor Cwf10, domain II {Schizosaccharomyces pombe 972h- [TaxId: 284812]} sprenaarkasqsyigpinssigkailemsreesaplvmhvtklyntvdannfyafarvy sgqvkkgqkvkvlgenysledeedmvvahiaeicvpcaryrlhvdgavagmlvllggvdn sisktativsdnlkddpyifrpia
Timeline for d3jb9b2:
View in 3D Domains from same chain: (mouse over for more information) d3jb9b1, d3jb9b3, d3jb9b4, d3jb9b5 |
View in 3D Domains from other chains: (mouse over for more information) d3jb9a1, d3jb9a2, d3jb9a3, d3jb9a4, d3jb9a5, d3jb9c_, d3jb9e_, d3jb9f_, d3jb9g_, d3jb9h_, d3jb9i_, d3jb9j_, d3jb9k_, d3jb9l_, d3jb9m_, d3jb9r_, d3jb9s1, d3jb9s2, d3jb9t1, d3jb9t2, d3jb9u1, d3jb9u2, d3jb9u3, d3jb9v1, d3jb9v2, d3jb9w_, d3jb9x1, d3jb9x2, d3jb9x3, d3jb9x4, d3jb9y1, d3jb9y2, d3jb9z_ |