Lineage for d3itza_ (3itz A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1435019Protein MAP kinase p38 [56129] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 1435020Species Human (Homo sapiens) [TaxId:9606] [56130] (161 PDB entries)
  8. 1435118Domain d3itza_: 3itz A: [178616]
    automated match to d1a9ua_
    complexed with p66

Details for d3itza_

PDB Entry: 3itz (more details), 2.25 Å

PDB Description: Crystal Structure of p38a Mitogen-Activated Protein Kinase in Complex with a Pyrazolopyridazine Inhibitor
PDB Compounds: (A:) Mitogen-activated protein kinase 14

SCOPe Domain Sequences for d3itza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3itza_ d.144.1.7 (A:) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]}
hmlemsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkkls
rpfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnni
vkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtd
demtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklil
rlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkr
itaaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppl

SCOPe Domain Coordinates for d3itza_:

Click to download the PDB-style file with coordinates for d3itza_.
(The format of our PDB-style files is described here.)

Timeline for d3itza_: