Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins) duplication: consists of 2 similar domains with 2 repeats in each Similar to the Methylmalonyl-CoA epimerase dimer |
Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (6 species) |
Species Human (Homo sapiens) [TaxId:9606] [110878] (1 PDB entry) |
Domain d3isqa2: 3isq A:175-384 [211940] automated match to d1sqia2 complexed with cl, co, edo, na |
PDB Entry: 3isq (more details), 1.75 Å
SCOPe Domain Sequences for d3isqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3isqa2 d.32.1.3 (A:175-384) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} kcslemidhivgnqpdqemvsasewylknlqfhrfwsvddtqvhteysslrsivvanyee sikmpinepapgkkksqiqeyvdynggagvqhialktediitairhlrergleflsvpst yykqlreklktakikvkenidaleelkilvdydekgyllqiftkpvqdrptlfleviqrh nhqgfgagnfnslfkafeeeqnlrgnltnm
Timeline for d3isqa2: