Lineage for d3iqja_ (3iqj A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1745105Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1745953Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 1745954Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 1746000Protein automated matches [190238] (5 species)
    not a true protein
  7. 1746009Species Human (Homo sapiens) [TaxId:9606] [187008] (38 PDB entries)
  8. 1746013Domain d3iqja_: 3iqj A: [178557]
    automated match to d1qjaa_
    complexed with cl, mg

Details for d3iqja_

PDB Entry: 3iqj (more details), 1.15 Å

PDB Description: crystal structure of human 14-3-3 sigma in complex with raf1 peptide (10mer)
PDB Compounds: (A:) 14-3-3 protein sigma

SCOPe Domain Sequences for d3iqja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iqja_ a.118.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gamgsmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggq
raawrvlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdae
srvfylkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglaln
fsvfhyeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt

SCOPe Domain Coordinates for d3iqja_:

Click to download the PDB-style file with coordinates for d3iqja_.
(The format of our PDB-style files is described here.)

Timeline for d3iqja_: