Class a: All alpha proteins [46456] (286 folds) |
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.7: 14-3-3 protein [48445] (1 family) automatically mapped to Pfam PF00244 |
Family a.118.7.1: 14-3-3 protein [48446] (5 proteins) |
Protein automated matches [190238] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187008] (38 PDB entries) |
Domain d3iqja_: 3iqj A: [178557] automated match to d1qjaa_ complexed with cl, mg |
PDB Entry: 3iqj (more details), 1.15 Å
SCOPe Domain Sequences for d3iqja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iqja_ a.118.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gamgsmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggq raawrvlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdae srvfylkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglaln fsvfhyeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt
Timeline for d3iqja_: