Lineage for d3imab_ (3ima B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2935698Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 2935875Family d.17.1.0: automated matches [191407] (1 protein)
    not a true family
  6. 2935876Protein automated matches [190558] (13 species)
    not a true protein
  7. 2935892Species Colocasia esculenta [TaxId:4460] [189213] (1 PDB entry)
  8. 2935893Domain d3imab_: 3ima B: [178397]
    Other proteins in same PDB: d3imaa_, d3imac_
    automated match to d1eqka_
    complexed with act

Details for d3imab_

PDB Entry: 3ima (more details), 2.03 Å

PDB Description: complex structure of tarocystatin and papain
PDB Compounds: (B:) Cysteine proteinase inhibitor

SCOPe Domain Sequences for d3imab_:

Sequence, based on SEQRES records: (download)

>d3imab_ d.17.1.0 (B:) automated matches {Colocasia esculenta [TaxId: 4460]}
almggivdvegaqnsaeveelarfavdehnkkenallqfsrlvkakqqvvsgimhhltve
vieggkkkvyeakvwvqawlnskklhefsp

Sequence, based on observed residues (ATOM records): (download)

>d3imab_ d.17.1.0 (B:) automated matches {Colocasia esculenta [TaxId: 4460]}
almggivdsaeveelarfavdehnkkenallqfsrlvkakqqvvsgimhhltvevieggk
kkvyeakvwvqawlnskklhefsp

SCOPe Domain Coordinates for d3imab_:

Click to download the PDB-style file with coordinates for d3imab_.
(The format of our PDB-style files is described here.)

Timeline for d3imab_: