Lineage for d3ihza_ (3ihz A:)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.26: FKBP-like [54533] (3 superfamilies)
core: beta(2)-alpha-beta(2); antiparallel beta-sheetSuperfamily d.26.1: FKBP-like [54534] (4 families) 
Family d.26.1.0: automated matches [191631] (1 protein)
not a true familyProtein automated matches [191162] (29 species)
not a true protein
Species Plasmodium vivax [TaxId:5855] [189364] (5 PDB entries) 
Domain d3ihza_: 3ihz A: [178329]
automated match to d1r9ha_
complexed with fk5
Details for d3ihza_
PDB Entry: 3ihz (more details), 1.67 Å
PDB Description: Crystal structure of the FK506 binding domain of Plasmodium vivax FKBP35 in complex with FK506
PDB Compounds: (A:) 70 kDa peptidylprolyl isomerase, putativeSCOPe Domain Sequences for d3ihza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ihza_ d.26.1.0 (A:) automated matches {Plasmodium vivax [TaxId: 5855]}
etleqvhltedggvvktilrkgeggeenapkkgnevtvhyvgklessgkvfdssrernvp
fkfhlgqgevikgwdicvasmtknekcsvrldskygygeegcgesipgnsvlifeielis
fre
SCOPe Domain Coordinates for d3ihza_:
Click to download the PDB-style file with coordinates for d3ihza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3ihza_:
- d3ihza_ first appeared in SCOPe 2.01
- d3ihza_ appears in SCOPe 2.06
- d3ihza_ appears in the current release, SCOPe 2.08
View in 3D
