Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) |
Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
Protein automated matches [191162] (29 species) not a true protein |
Species Plasmodium vivax [TaxId:5855] [189364] (5 PDB entries) |
Domain d3ihza_: 3ihz A: [178329] automated match to d1r9ha_ complexed with fk5 |
PDB Entry: 3ihz (more details), 1.67 Å
SCOPe Domain Sequences for d3ihza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ihza_ d.26.1.0 (A:) automated matches {Plasmodium vivax [TaxId: 5855]} etleqvhltedggvvktilrkgeggeenapkkgnevtvhyvgklessgkvfdssrernvp fkfhlgqgevikgwdicvasmtknekcsvrldskygygeegcgesipgnsvlifeielis fre
Timeline for d3ihza_: