Lineage for d3ihza_ (3ihz A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1408347Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1408348Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1408627Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 1408628Protein automated matches [191162] (11 species)
    not a true protein
  7. 1408668Species Plasmodium vivax [TaxId:5855] [189364] (4 PDB entries)
  8. 1408673Domain d3ihza_: 3ihz A: [178329]
    automated match to d1r9ha_
    complexed with fk5

Details for d3ihza_

PDB Entry: 3ihz (more details), 1.67 Å

PDB Description: Crystal structure of the FK506 binding domain of Plasmodium vivax FKBP35 in complex with FK506
PDB Compounds: (A:) 70 kDa peptidylprolyl isomerase, putative

SCOPe Domain Sequences for d3ihza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ihza_ d.26.1.0 (A:) automated matches {Plasmodium vivax [TaxId: 5855]}
etleqvhltedggvvktilrkgeggeenapkkgnevtvhyvgklessgkvfdssrernvp
fkfhlgqgevikgwdicvasmtknekcsvrldskygygeegcgesipgnsvlifeielis
fre

SCOPe Domain Coordinates for d3ihza_:

Click to download the PDB-style file with coordinates for d3ihza_.
(The format of our PDB-style files is described here.)

Timeline for d3ihza_: