Lineage for d3igxb_ (3igx B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1821671Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1822946Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 1822947Protein automated matches [190115] (63 species)
    not a true protein
  7. 1823159Species Francisella tularensis [TaxId:177416] [189018] (3 PDB entries)
  8. 1823161Domain d3igxb_: 3igx B: [178320]
    automated match to d1onra_
    complexed with po4

Details for d3igxb_

PDB Entry: 3igx (more details), 1.85 Å

PDB Description: 1.85 angstrom resolution crystal structure of transaldolase b (tala) from francisella tularensis.
PDB Compounds: (B:) Transaldolase

SCOPe Domain Sequences for d3igxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3igxb_ c.1.10.0 (B:) automated matches {Francisella tularensis [TaxId: 177416]}
qksvleqlkqvtmvvadtgdfelikkykpvdattnpslilkavkeqkysnlvaetiskvk
annpdlnsddlvkeiaieilvsfgikildviegkvssevdarvsfnsattidyakriiar
yesngipkdrvlikiaatwegikaakllqkegincnltlifdkaqakacaeagvylvspf
vgritdwqmqqnnlktfpaiadddgvnsvkaiyklykshgfktivmgasfrnveqviala
gcdaltispvlleelknrdehlevkltknddvvtqspqiseadfrwlmnenamathklae
girlftkdtieleniikqnl

SCOPe Domain Coordinates for d3igxb_:

Click to download the PDB-style file with coordinates for d3igxb_.
(The format of our PDB-style files is described here.)

Timeline for d3igxb_: