Lineage for d3ieja_ (3iej A:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.3: Cysteine proteinases [54000] (1 superfamily)
consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-AsnSuperfamily d.3.1: Cysteine proteinases [54001] (23 families) 
the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
Family d.3.1.1: Papain-like [54002] (26 proteins) 
Protein (Pro)cathepsin S [82566] (1 species) Species Human (Homo sapiens) [TaxId:9606] [82567] (23 PDB entries) 
Domain d3ieja_: 3iej A: [178271]
automated match to d1gloa_
complexed with 599
Details for d3ieja_
PDB Entry: 3iej (more details), 2.18 Å
PDB Description: pyrazole-based cathepsin s inhibitors with arylalkynes as p1 binding elements
PDB Compounds: (A:) cathepsin SSCOPe Domain Sequences for d3ieja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ieja_ d.3.1.1 (A:) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]}
aalpdsvdwrekgcvtevkyqgscgaswafsavgaleaqlklktgklvslsaqnlvdcst
ekygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpy
gredvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngke
ywlvknswghnfgeegyirmarnkgnhcgiasfpsypeilq
SCOPe Domain Coordinates for d3ieja_:
Click to download the PDB-style file with coordinates for d3ieja_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3ieja_:
- d3ieja_ first appeared in SCOPe 2.01
- d3ieja_ appears in SCOPe 2.04
- d3ieja_ is called d3ieja1 in SCOPe 2.06
- d3ieja_ appears in the current release, SCOPe 2.08, called d3ieja1
View in 3D
