Lineage for d3i76b_ (3i76 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1883149Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1883150Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1883848Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 1883849Protein automated matches [190447] (49 species)
    not a true protein
  7. 1883870Species Bacillus subtilis [TaxId:1423] [188499] (5 PDB entries)
  8. 1883875Domain d3i76b_: 3i76 B: [178124]
    automated match to d2gfha1
    complexed with cl, gol, mg

Details for d3i76b_

PDB Entry: 3i76 (more details), 2 Å

PDB Description: the crystal structure of the orthorhombic form of the putative had- hydrolase yfnb from bacillus subtilis bound to magnesium reveals interdomain movement
PDB Compounds: (B:) Putative HAD-hydrolase yfnB

SCOPe Domain Sequences for d3i76b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i76b_ c.108.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
kryrtllfdvddtildfqaaealalrllfedqnipltndmkaqyktinqglwrafeegkm
trdevvntrfsallkeygyeadgalleqkyrrfleeghqlidgafdlisnlqqqfdlyiv
tngvshtqykrlrdsglfpffkdifvsedtgfqkpmkeyfnyvferipqfsaehtliigd
sltadikggqlagldtcwmnpdmkpnvpeiiptyeirkleelyhilnie

SCOPe Domain Coordinates for d3i76b_:

Click to download the PDB-style file with coordinates for d3i76b_.
(The format of our PDB-style files is described here.)

Timeline for d3i76b_: