Lineage for d3i54a1 (3i54 A:-5-144)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1807020Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1808270Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 1808496Family b.82.3.0: automated matches [227198] (1 protein)
    not a true family
  6. 1808497Protein automated matches [226927] (11 species)
    not a true protein
  7. 1808522Species Mycobacterium tuberculosis [TaxId:1773] [231918] (4 PDB entries)
  8. 1808525Domain d3i54a1: 3i54 A:-5-144 [232550]
    Other proteins in same PDB: d3i54b2, d3i54c2, d3i54d2
    automated match to d3r6sf1
    protein/DNA complex; complexed with cmp

Details for d3i54a1

PDB Entry: 3i54 (more details), 2.2 Å

PDB Description: crystal structure of mtbcrp in complex with camp
PDB Compounds: (A:) transcriptional regulator, Crp/Fnr family

SCOPe Domain Sequences for d3i54a1:

Sequence, based on SEQRES records: (download)

>d3i54a1 b.82.3.0 (A:-5-144) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
lyfqshmdeilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisgk
vkigrrapdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswia
drpeiseqllrvlarrlrrtnnnladlift

Sequence, based on observed residues (ATOM records): (download)

>d3i54a1 b.82.3.0 (A:-5-144) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
lyfqshmdeilaragifqgvepsaiaaqpvdfprghtvfaegepgdrlyiiisgkvkigr
rapdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrpei
seqllrvlarrlrrtnnnladlift

SCOPe Domain Coordinates for d3i54a1:

Click to download the PDB-style file with coordinates for d3i54a1.
(The format of our PDB-style files is described here.)

Timeline for d3i54a1: