Lineage for d3i3ac_ (3i3a C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813832Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2813833Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2814180Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 2814181Protein automated matches [190967] (36 species)
    not a true protein
  7. 2814291Species Leptospira interrogans [TaxId:173] [188993] (3 PDB entries)
  8. 2814300Domain d3i3ac_: 3i3a C: [178042]
    automated match to d1lxaa_
    complexed with s2n

Details for d3i3ac_

PDB Entry: 3i3a (more details), 2.12 Å

PDB Description: Structural Basis for the Sugar Nucleotide and Acyl Chain Selectivity of Leptospira interrogans LpxA
PDB Compounds: (C:) acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase

SCOPe Domain Sequences for d3i3ac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i3ac_ b.81.1.0 (C:) automated matches {Leptospira interrogans [TaxId: 173]}
mkihptaiidpkaelhesvevgpysiiegnvsiqegtiieghvkicagseigkfnrfhqg
avigvmpqdlgfnqqlltktvigdhnifreysnihkgtkedsptvignknyfmgnshvgh
dcilgnnnilthgavlaghvtlgnfafisglvavhqfcfvgdysmvaglakvvqdvppys
tvdgnpstvvglnsvgmkragfspevrnaikhaykviyhsgistrkaldeleasgnlieq
vkyiikffrdsdrgvtnhr

SCOPe Domain Coordinates for d3i3ac_:

Click to download the PDB-style file with coordinates for d3i3ac_.
(The format of our PDB-style files is described here.)

Timeline for d3i3ac_: