| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
| Protein automated matches [190770] (51 species) not a true protein |
| Species Rhodococcus sp. [TaxId:104109] [232531] (10 PDB entries) |
| Domain d3i2ja2: 3i2j A:352-574 [232540] Other proteins in same PDB: d3i2ja1, d3i2ja3 automated match to d1ju3a1 complexed with cl, gol, so4 |
PDB Entry: 3i2j (more details), 2.01 Å
SCOPe Domain Sequences for d3i2ja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i2ja2 b.18.1.0 (A:352-574) automated matches {Rhodococcus sp. [TaxId: 104109]}
plpdtaytpfylggsgaantstgggtlstsisgtesadtylydpadpvpslggtllfhng
dngpadqrpihdrddvlcystevltdpvevtgtvsarlfvsssavdtdftaklvdvfpdg
raialcdgivrmryretlvnptlieageiyevaidmlatsnvflpghrimvqvsssnfpk
ydrnsntggviareqleemctavnrihrgpehpshivlpiikr
Timeline for d3i2ja2: