![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
![]() | Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) ![]() related to the ferredoxin reductase-like FAD-binding domain |
![]() | Family b.45.1.1: PNP-oxidase like [50476] (17 proteins) |
![]() | Protein automated matches [190383] (6 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188118] (3 PDB entries) |
![]() | Domain d3hy8a_: 3hy8 A: [246605] automated match to d1nrga_ complexed with fmn, plp, po4; mutant |
PDB Entry: 3hy8 (more details), 2.5 Å
SCOPe Domain Sequences for d3hy8a_:
Sequence, based on SEQRES records: (download)
>d3hy8a_ b.45.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} feethltsldpvkqfaawfeeavqcpdigeanamclatctrdgkpsarmlllkgfgkdgf rfftnfesrkgkeldsnpfaslvfyweplnrqvrvegpvkklpeeeaecyfhsrpkssqi gavvshqssvipdreylrkkneeleqlyqdqevpkpkswggyvlypqvmefwqgqtnrlh dwivfrrglptgdsplgpmthrgeedwlyerlap
>d3hy8a_ b.45.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} feethltsldpvkqfaawfeeavqcpdigeanamclatctrdgkpsarmlllkgfgkdgf rfftnfesrkgkeldsnpfaslvfyweplnrqvrvegpvkklpeeeaecyfhsrpkssqi gavvshqssvipdreylrkkneeleqlyqdqevpkpkswggyvlypqvmefwqgqtnrlh dwivfrrglptplgpmthrgeedwlyerlap
Timeline for d3hy8a_: