Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species) Class I MHC-related |
Species Human (Homo sapiens), CD1a [TaxId:9606] [102838] (8 PDB entries) |
Domain d3hujc1: 3huj C:5-183 [199526] Other proteins in same PDB: d3huja2, d3hujb_, d3hujc2, d3hujd_, d3huje1, d3huje2, d3hujf1, d3hujf2, d3hujg1, d3hujg2, d3hujh1, d3hujh2 automated match to d1onqa2 complexed with agh, mg, nag, ndg |
PDB Entry: 3huj (more details), 2.5 Å
SCOPe Domain Sequences for d3hujc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hujc1 d.19.1.1 (C:5-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a [TaxId: 9606]} qrlfplrclqissfansswtrtdglawlgelqthswsndsdtvrslkpwsqgtfsdqqwe tlqhifrvyrssftrdvkefakmlrlsyplelqvsagcevhpgnasnnffhvafqgkdil sfqgtsweptqeaplwvnlaiqvlnqdkwtretvqwllngtcpqfvsgllesgkselkk
Timeline for d3hujc1: