Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.0: automated matches [191632] (1 protein) not a true family |
Protein automated matches [191164] (14 species) not a true protein |
Species Rhodopseudomonas palustris [TaxId:1076] [225824] (1 PDB entry) |
Domain d3huia_: 3hui A: [211306] automated match to d3lb8c_ complexed with fes; mutant |
PDB Entry: 3hui (more details), 2.01 Å
SCOPe Domain Sequences for d3huia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3huia_ d.15.4.0 (A:) automated matches {Rhodopseudomonas palustris [TaxId: 1076]} vprgshmakinfvdhtgetrtveveegatvmeaairnaipgveaecggacacatchvyvd eawrekvggpspmeedmldfgydvrpnsrlscqikvsneldglivttperqr
Timeline for d3huia_: