Lineage for d3hu5a_ (3hu5 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864173Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2864174Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 2864227Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 2864228Protein automated matches [190499] (26 species)
    not a true protein
  7. 2864272Species Desulfovibrio vulgaris [TaxId:882] [225697] (1 PDB entry)
  8. 2864273Domain d3hu5a_: 3hu5 A: [211304]
    automated match to d3kl2e_

Details for d3hu5a_

PDB Entry: 3hu5 (more details), 1.5 Å

PDB Description: crystal structure of isochorismatase family protein from desulfovibrio vulgaris subsp. vulgaris str. hildenborough
PDB Compounds: (A:) isochorismatase family protein

SCOPe Domain Sequences for d3hu5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hu5a_ c.33.1.0 (A:) automated matches {Desulfovibrio vulgaris [TaxId: 882]}
nrtvalaiidmqndfvlpgapacvegamgtvpviagllakaraegwmvlhvvrahradgs
daeksrehlfleggglcvagtpgaeivaglepasgetvlvktrfsafmgtecdmllrrrg
vdtllvsgtqypncirgtavdafaldydvvvvtdacsartpgvaesnindmramgitcvp
ltalddvlar

SCOPe Domain Coordinates for d3hu5a_:

Click to download the PDB-style file with coordinates for d3hu5a_.
(The format of our PDB-style files is described here.)

Timeline for d3hu5a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3hu5b_