Lineage for d3hu5a_ (3hu5 A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) 
Family c.33.1.0: automated matches [191389] (1 protein)
not a true familyProtein automated matches [190499] (26 species)
not a true protein
Species Desulfovibrio vulgaris [TaxId:882] [225697] (1 PDB entry) 
Domain d3hu5a_: 3hu5 A: [211304]
automated match to d3kl2e_
Details for d3hu5a_
PDB Entry: 3hu5 (more details), 1.5 Å
PDB Description: crystal structure of isochorismatase family protein from desulfovibrio vulgaris subsp. vulgaris str. hildenborough
PDB Compounds: (A:) isochorismatase family proteinSCOPe Domain Sequences for d3hu5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hu5a_ c.33.1.0 (A:) automated matches {Desulfovibrio vulgaris [TaxId: 882]}
nrtvalaiidmqndfvlpgapacvegamgtvpviagllakaraegwmvlhvvrahradgs
daeksrehlfleggglcvagtpgaeivaglepasgetvlvktrfsafmgtecdmllrrrg
vdtllvsgtqypncirgtavdafaldydvvvvtdacsartpgvaesnindmramgitcvp
ltalddvlar
SCOPe Domain Coordinates for d3hu5a_:
Click to download the PDB-style file with coordinates for d3hu5a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3hu5a_:
- d3hu5a_ first appeared in SCOPe 2.03
- d3hu5a_ appears in SCOPe 2.07
View in 3D
