Lineage for d3htta_ (3htt A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.19: Viral protein domain [49817] (1 superfamily)
sandwich; 9 strands in 2 sheets; jelly-roll; form trimersSuperfamily b.19.1: Viral protein domain [49818] (4 families) 
forms homotrimersFamily b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) 
Protein automated matches [190291] (19 species)
not a true protein
Species Influenza A virus (a/wdk/jx/12416/2005(h1n1)) [TaxId:666057] [188994] (4 PDB entries) 
Domain d3htta_: 3htt A: [177838]
Other proteins in same PDB: d3httb_
automated match to d1rd8a_
complexed with nag
Details for d3htta_
PDB Entry: 3htt (more details), 2.95 Å
PDB Description: the hemagglutinin structure of an avian h1n1 influenza a virus in complex with 2,3-sialyllactose
PDB Compounds: (A:) HemagglutininSCOPe Domain Sequences for d3htta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3htta_ b.19.1.2 (A:) automated matches {Influenza A virus (a/wdk/jx/12416/2005(h1n1)) [TaxId: 666057]}
dticigyhannstdtvdtvleknvtvthsvnllednhngklcklngiaplqlgkcnvagw
llgnpecdllltanswsyiietsnsengtcypgefidyeelreqlssvssferfeifpka
sswpnhettkgvtaacsyfgassfyrnllwitkkgtsypklsksytnnkgkevlvlwgvh
hppttseqqtlyqntdayvsvgsskynrrftpeiaarpkvrgqagrmnyywtlldqgdti
tfeatgnliapwyafalnkgsdsgiitsdapvhncdtkcqtphgainstlpfqnvhpiti
gecpkyvkstklrmatglrnipsi
SCOPe Domain Coordinates for d3htta_:
Click to download the PDB-style file with coordinates for d3htta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3htta_:
- d3htta_ first appeared in SCOPe 2.01
- d3htta_ appears in SCOPe 2.07
View in 3D
