Lineage for d3hsyb_ (3hsy B:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
parallel beta-sheet of 6 strands, order 213456Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) 
Similar in architecture to the superfamily II but partly differs in topologyFamily c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins) 
Protein Ionotropic glutamate receptor 2 (GluR2) amino-terminal domain (ATD) [267661] (1 species) Species Norway rat (Rattus norvegicus) [TaxId:10116] [267740] (8 PDB entries) 
Domain d3hsyb_: 3hsy B: [264837]
automated match to d3h5va_
complexed with nag, so4
Details for d3hsyb_
PDB Entry: 3hsy (more details), 1.75 Å
PDB Description: high resolution structure of a dimeric glur2 n-terminal domain (ntd)
PDB Compounds: (B:) Glutamate receptor 2SCOPe Domain Sequences for d3hsyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hsyb_ c.93.1.1 (B:) Ionotropic glutamate receptor 2 (GluR2) amino-terminal domain (ATD) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkke
rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfgganvsgfqivd
yddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrr
gnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngpr
kigywsevdkmvvtlt
SCOPe Domain Coordinates for d3hsyb_:
Click to download the PDB-style file with coordinates for d3hsyb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3hsyb_:
- d3hsyb_ first appeared in SCOPe 2.05
- d3hsyb_ appears in SCOPe 2.06
- d3hsyb_ appears in the current release, SCOPe 2.08
View in 3D
