Lineage for d3hs3a_ (3hs3 A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
parallel beta-sheet of 6 strands, order 213456Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) 
Similar in architecture to the superfamily II but partly differs in topology
Family c.93.1.0: automated matches [191439] (1 protein)
not a true familyProtein automated matches [190646] (60 species)
not a true protein
Species Lactobacillus acidophilus [TaxId:1579] [196560] (1 PDB entry) 
Domain d3hs3a_: 3hs3 A: [199523]
automated match to d3hs3b_
Details for d3hs3a_
PDB Entry: 3hs3 (more details), 1.6 Å
PDB Description: crystal structure of periplasmic binding ribose operon repressor protein from lactobacillus acidophilus
PDB Compounds: (A:) Ribose operon repressorSCOPe Domain Sequences for d3hs3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hs3a_ c.93.1.0 (A:) automated matches {Lactobacillus acidophilus [TaxId: 1579]}
kkskmigiiipdlnnrfyaqiidgiqeviqkegytalisfstnsdvkkyqnaiinfennn
vdgiitsaftippnfhlntplvmydsaninddivrivsnntkggkesikllskkiekvli
qhwplslptirerieamtaeasklkidylleetpennpyisaqsalnksnqfdaiitvnd
lyaaeiikeakrrnlkipddfqlvgydnnilcgytsptistidqnpkligqtaahrlldl
msgnnstrnsiidvlpikrdsteg
SCOPe Domain Coordinates for d3hs3a_:
Click to download the PDB-style file with coordinates for d3hs3a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3hs3a_:
- d3hs3a_ first appeared in SCOPe 2.03
- d3hs3a_ appears in SCOPe 2.04
- d3hs3a_ is called d3hs3a1 in SCOPe 2.06
- d3hs3a_ appears in the current release, SCOPe 2.08, called d3hs3a1
View in 3D
