Lineage for d3hs3a_ (3hs3 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1624506Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 1624507Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 1624744Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 1624745Protein automated matches [190646] (49 species)
    not a true protein
  7. 1624859Species Lactobacillus acidophilus [TaxId:1579] [196560] (1 PDB entry)
  8. 1624860Domain d3hs3a_: 3hs3 A: [199523]
    automated match to d3hs3b_

Details for d3hs3a_

PDB Entry: 3hs3 (more details), 1.6 Å

PDB Description: crystal structure of periplasmic binding ribose operon repressor protein from lactobacillus acidophilus
PDB Compounds: (A:) Ribose operon repressor

SCOPe Domain Sequences for d3hs3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hs3a_ c.93.1.0 (A:) automated matches {Lactobacillus acidophilus [TaxId: 1579]}
kkskmigiiipdlnnrfyaqiidgiqeviqkegytalisfstnsdvkkyqnaiinfennn
vdgiitsaftippnfhlntplvmydsaninddivrivsnntkggkesikllskkiekvli
qhwplslptirerieamtaeasklkidylleetpennpyisaqsalnksnqfdaiitvnd
lyaaeiikeakrrnlkipddfqlvgydnnilcgytsptistidqnpkligqtaahrlldl
msgnnstrnsiidvlpikrdsteg

SCOPe Domain Coordinates for d3hs3a_:

Click to download the PDB-style file with coordinates for d3hs3a_.
(The format of our PDB-style files is described here.)

Timeline for d3hs3a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3hs3b_