Lineage for d3hrea_ (3hre A:)
- Root: SCOPe 2.07
Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
contains a cluster of helices and an alpha+beta sandwichSuperfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) 
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) Protein automated matches [190161] (30 species)
not a true proteinSpecies Escherichia coli [TaxId:562] [187306] (106 PDB entries) 
Domain d3hrea_: 3hre A: [177794]
automated match to d1iysa_
complexed with po4
Details for d3hrea_
PDB Entry: 3hre (more details), 1.45 Å
PDB Description: x-ray crystallographic structure of ctx-m-9 s70g
PDB Compounds: (A:) CTX-M-9 extended-spectrum beta-lactamaseSCOPe Domain Sequences for d3hrea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hrea_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
qtsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcgtskvmaaaavlkqse
tqkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra
qlvtwlkgnttgaasiraglptswtagdktgsgdygttndiaviwpqgraplvlvtyftq
pqqnaesrrdvlasaariiaegl
SCOPe Domain Coordinates for d3hrea_:
Click to download the PDB-style file with coordinates for d3hrea_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3hrea_:
- d3hrea_ first appeared in SCOPe 2.01
- d3hrea_ appears in SCOPe 2.06
- d3hrea_ appears in the current release, SCOPe 2.08
View in 3D
