Lineage for d3hoga_ (3hog A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1522748Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 1522749Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 1523223Protein automated matches [190916] (9 species)
    not a true protein
  7. 1523242Species Solanum lycopersicum [TaxId:4081] [196089] (6 PDB entries)
  8. 1523243Domain d3hoga_: 3hog A: [211171]
    automated match to d3pu7b_
    complexed with k

Details for d3hoga_

PDB Entry: 3hog (more details), 1.85 Å

PDB Description: Metal-free Tomato Chloroplast Superoxide Dismutase
PDB Compounds: (A:) Superoxide dismutase [Cu-Zn], chloroplastic

SCOPe Domain Sequences for d3hoga_:

Sequence, based on SEQRES records: (download)

>d3hoga_ b.1.8.1 (A:) automated matches {Solanum lycopersicum [TaxId: 4081]}
atkkavavlkgnsnvegvvtlsqdddgpttvnvritglapglhgfhlheygdttngcmst
gahfnpnklthgapgdeirhagdlgnivanadgvaevtlvdnqipltgpnsvvgralvvh
eleddlgkgghelslttgnaggrlacgvvgltpi

Sequence, based on observed residues (ATOM records): (download)

>d3hoga_ b.1.8.1 (A:) automated matches {Solanum lycopersicum [TaxId: 4081]}
atkkavavlkgnsnvegvvtlsqdddgpttvnvritglapglhgfhlheygdttngcmst
gahfnpnklthhagdlgnivanadgvaevtlvdnqipltgpnsvvgralvvhelgrlacg
vvgltpi

SCOPe Domain Coordinates for d3hoga_:

Click to download the PDB-style file with coordinates for d3hoga_.
(The format of our PDB-style files is described here.)

Timeline for d3hoga_: