Lineage for d3hjna_ (3hjn A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2129253Species Thermotoga maritima [TaxId:243274] [188915] (5 PDB entries)
  8. 2129255Domain d3hjna_: 3hjn A: [177613]
    automated match to d4tmka_
    complexed with adp, mg, tyd

Details for d3hjna_

PDB Entry: 3hjn (more details), 2.1 Å

PDB Description: Crystal structure of thymidylate kinase in complex with dTDP and ADP from Thermotoga maritima
PDB Compounds: (A:) thymidylate kinase

SCOPe Domain Sequences for d3hjna_:

Sequence, based on SEQRES records: (download)

>d3hjna_ c.37.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
mfitfegidgsgkstqiqllaqylekrgkkvilkrepggtetgekirkilleeevtpkae
lflflasrnllvteikqylsegyavlldrytdssvayqgfgrnlgkeiveelndfatdgl
ipdltfyidvdvetalkrkgelnrfekreflervregylvlarehperivvldgkrsiee
ihrdvvrevkrr

Sequence, based on observed residues (ATOM records): (download)

>d3hjna_ c.37.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
mfitfegidgsgkstqiqllaqylekrgkkvilkrepggtetgekirkilleeevtpkae
lflflasrnllvteikqylsegyavlldrytdssvayqgfgrnlgkeiveelndfatdgl
ipdltfyidvdvetalkrknrfekreflervregylvlarehperivvldgkrsieeihr
dvvrevkrr

SCOPe Domain Coordinates for d3hjna_:

Click to download the PDB-style file with coordinates for d3hjna_.
(The format of our PDB-style files is described here.)

Timeline for d3hjna_: